PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_31980V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 349aa    MW: 38282.2 Da    PI: 7.911
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_31980V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.95.7e-2873123151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                        k+ien++ rqvtfskRr g+lKKA+EL vLCdaeva++ifsstgkl+ey+s
  Pp3c3_31980V3.4.p  73 KKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKLFEYAS 123
                        68***********************************************86 PP

2K-box812.9e-271432321099
              K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        + a +  +  e+ kL++++e+L+ ++Rh+lGedL+ L++ +L qLeqqL+ + +++R++Kn+l+le++e l++ke+el  +n++Lr+kl+
  Pp3c3_31980V3.4.p 143 NGARNDFMGCEVVKLREQLEQLKASHRHMLGEDLSLLKVPDLLQLEQQLDLGASRVRARKNQLILEEVESLRRKEHELLIANEDLRQKLA 232
                        5566778889******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.88465125IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-4265124IPR002100Transcription factor, MADS-box
CDDcd002654.18E-4466143No hitNo description
SuperFamilySSF554552.75E-3266143IPR002100Transcription factor, MADS-box
PROSITE patternPS00350067121IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-306787IPR002100Transcription factor, MADS-box
PfamPF003191.5E-2574121IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-3087102IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-30102123IPR002100Transcription factor, MADS-box
PfamPF014862.9E-24147231IPR002487Transcription factor, K-box
PROSITE profilePS5129715.351147237IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MTASGQSCKQ WQFGAVPSTA TQESSSEIIL HGDCEVPTYL SLGVACGTGG DSTYSTESRS  60
KGRVMGRGKI EIKKIENTTS RQVTFSKRRG GLLKKAHELA VLCDAEVALV IFSSTGKLFE  120
YASSGSIRDI IDRYKKGSDG MQNGARNDFM GCEVVKLREQ LEQLKASHRH MLGEDLSLLK  180
VPDLLQLEQQ LDLGASRVRA RKNQLILEEV ESLRRKEHEL LIANEDLRQK LADAQGIADA  240
VTARANVSES PRPLTSALTR DIVMSSQQQE VTVHPHPNLR DAQRSQTSLQ LGMFSSESYL  300
PSSSRGPSEH PIPVGPEGCA GESAMRWEHP HFHSQNRLHA NISPSVRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A4e-1966124159Myocyte-specific enhancer factor 2A
3mu6_B4e-1966124159Myocyte-specific enhancer factor 2A
3mu6_C4e-1966124159Myocyte-specific enhancer factor 2A
3mu6_D4e-1966124159Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.133320.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1509330.0AF150933.1 Physcomitrella patens MADS-domain protein PPM2 (ppm2) mRNA, complete cds.
GenBankAJ4193280.0AJ419328.1 Physcomitrella patens mRNA for putative MADS-domain transcription factor (m2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001762612.10.0MIKCC MADS-domain protein PPM2
SwissprotQ9XGJ47e-59GGM13_GNEGN; MADS-box protein GGM13
TrEMBLQ9FE890.0Q9FE89_PHYPA; MADS-domain protein PPM2
STRINGPP1S55_304V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.17e-50MIKC_MADS family protein